Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial caf1 protein

This Bacterial caf1 protein spans the amino acid sequence from region 22-170aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Caf1, YPMT1.84, Y1100, YP_pMT082F1 capsule antigen

UniProt

P26948

Expression Region

22-170aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Yersinia pestis

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 10xHis-tagged: N-terminal 6xHis-tagged185-366AA: 22-170AAPartial: Full length of mature protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADLTASTTATATLVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HGF Human shRNA Lentiviral Particle (Locus ID 3082)
TL312467V 500 µL Each

HGF Human shRNA Lentiviral Particle (Locus ID 3082)

Sign In for Pricing
View Details
PKC delta, NT (Protein Kinase C, delta Type, nPKC-delta, PRKCD)
P9103-19C7 200 µL

PKC delta, NT (Protein Kinase C, delta Type, nPKC-delta, PRKCD)

Sign In for Pricing
View Details
IL28A Rabbit Polyclonal Antibody (HRP)
orb479900 100 µL

IL28A Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
4- (Fur-2-yl) benzoic acid
OR7401-01 250 mg

4- (Fur-2-yl) benzoic acid

Sign In for Pricing
View Details
4- (Fur-2-yl) benzoic acid
OR7401-02 5 g

4- (Fur-2-yl) benzoic acid

Sign In for Pricing
View Details
JMJD6 Antibody
A58589-100UL 100 µL

JMJD6 Antibody

Sign In for Pricing
View Details