Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial caf1 protein

This Bacterial caf1 protein spans the amino acid sequence from region 22-170aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Caf1, YPMT1.84, Y1100, YP_pMT082F1 capsule antigen

UniProt

P26948

Expression Region

22-170aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Yersinia pestis

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 10xHis-tagged: N-terminal 6xHis-tagged185-366AA: 22-170AAPartial: Full length of mature protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADLTASTTATATLVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human FOXJ1 Protein, His (Fc)-Avi-tagged
FOXJ1-2971H 50 µg

Recombinant Human FOXJ1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
SLC6A12 Rabbit pAb
A10378 50 µL

SLC6A12 Rabbit pAb

Sign In for Pricing
View Details
Anti-Ikaros/IKZF1 Antibody Picoband®
PB9643 100 µg/Vial

Anti-Ikaros/IKZF1 Antibody Picoband®

Sign In for Pricing
View Details
HGD Lentiviral Activation Particles (h2)
sc-407133-LAC-2 200 µL

HGD Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
TRNAT18 sgRNA CRISPR Lentivector (Human) (Target 2)
K2527203 1.0 µg DNA

TRNAT18 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Histone H2A.X Mouse Monoclonal Antibody
orb2988347-01 30 µL

Histone H2A.X Mouse Monoclonal Antibody

Sign In for Pricing
View Details