Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial polC protein

This Bacterial polC protein spans the amino acid sequence from region 287-832aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PolC, CENSYa_1827DNA polymerase II large subunit, Pol II, EC 2.7.7.7, Exodeoxyribonuclease large subunit, EC 3.1.11.1

UniProt

A0RYM0

Expression Region

287-832aa

Tag

Tag-Free

Source

E.coli

Origin

Cenarchaeum symbiosum (strain A)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

59 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-tagged: NO-tagged20-685AA: 287-832AAFull Length: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LAELKGAVQTGENKEDAAAKRMREVITGRSVLSMPNRLGGFRLRYGRACNTGYTSVGFHPAVAEILDHTIAVGTQVKIDIPGKGATVAFVDTIEAPTVRLAGGDVVKIRDVAHGIELKGSIERILHLGDMLISFGDFLENNAQLVPSGYVEEIWKMDMEAAGAAQGSPSSADEAVRISRELGVPLHPRYLYYWDQISHEELAMLLSPLDKGDAISYPAACKPVLEKLGVPHKAGPEGPVLEGDEARIFRELILDNPPGPDASAPVPELISRSSGITIRDKFSTSIGVRIGRPEKAAPRQMRPPTHCLFPVGGTGGPTNNLLKSAARPGFSADILSRRCPGCGEPSISIRCWACGERTAVERTCMQCGTDVDGEECERCGRPGLAHSRVEFPLKKMLVSAQEKTGVRAHDPLKGVKELAHQDRIAEPLEKGLIRQSRSLTVFKDGTVRFDATNSPMTHFKPSWIGTSAEKLRELGYETDVDGKKLEGPDQLVELRMQDIVIPLEGAKYLVSACGYIDAELDKLYGAPPFYKVPDLGGLIGHLVVGLA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARHGEF38 (m) -PR
sc-140524-PR 10 µM - 20 µL

ARHGEF38 (m) -PR

Sign In for Pricing
View Details
CD68 Antibody
E38PA3827 100 µL

CD68 Antibody

Sign In for Pricing
View Details
Recombinant Coxiella burnetii 5'-nucleotidase surE (surE)
MBS1222960-01 0.02 mg (E-Coli)

Recombinant Coxiella burnetii 5'-nucleotidase surE (surE)

Sign In for Pricing
View Details
Recombinant Coxiella burnetii 5'-nucleotidase surE (surE)
MBS1222960-02 0.1 mg (E-Coli)

Recombinant Coxiella burnetii 5'-nucleotidase surE (surE)

Sign In for Pricing
View Details
Recombinant Coxiella burnetii 5'-nucleotidase surE (surE)
MBS1222960-03 0.02 mg (Baculovirus)

Recombinant Coxiella burnetii 5'-nucleotidase surE (surE)

Sign In for Pricing
View Details
Recombinant Coxiella burnetii 5'-nucleotidase surE (surE)
MBS1222960-04 0.02 mg (Mammalian-Cell)

Recombinant Coxiella burnetii 5'-nucleotidase surE (surE)

Sign In for Pricing
View Details