Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Ins1 protein

This Mouse Ins1 protein spans the amino acid sequence from region 25-108aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ins1, Ins-1, Insulin-1 [Cleaved into, Insulin-1 B chain, Insulin-1 A chain]

UniProt

P01325

Expression Region

25-108aa

Tag

N-terminal 6xHis-tagged and C-terminal Myc-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 10xHis-tagged: N-terminal 6xHis-tagged and C-terminal Myc-tagged38-689AA: 25-108AAFull Length of Mature Protein : Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVEQLELGGSPGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Thermoanaerobacter tengcongensis Probable butyrate kinase 2 (buk2)
MBS1451196-01 0.05 mg (E-Coli)

Recombinant Thermoanaerobacter tengcongensis Probable butyrate kinase 2 (buk2)

Sign In for Pricing
View Details
Recombinant Thermoanaerobacter tengcongensis Probable butyrate kinase 2 (buk2)
MBS1451196-02 0.05 mg (Yeast)

Recombinant Thermoanaerobacter tengcongensis Probable butyrate kinase 2 (buk2)

Sign In for Pricing
View Details
Recombinant Thermoanaerobacter tengcongensis Probable butyrate kinase 2 (buk2)
MBS1451196-03 0.05 mg (Baculovirus)

Recombinant Thermoanaerobacter tengcongensis Probable butyrate kinase 2 (buk2)

Sign In for Pricing
View Details
Recombinant Thermoanaerobacter tengcongensis Probable butyrate kinase 2 (buk2)
MBS1451196-04 0.2 mg (E-Coli)

Recombinant Thermoanaerobacter tengcongensis Probable butyrate kinase 2 (buk2)

Sign In for Pricing
View Details
Recombinant Thermoanaerobacter tengcongensis Probable butyrate kinase 2 (buk2)
MBS1451196-05 0.5 mg (E-Coli)

Recombinant Thermoanaerobacter tengcongensis Probable butyrate kinase 2 (buk2)

Sign In for Pricing
View Details
Recombinant Thermoanaerobacter tengcongensis Probable butyrate kinase 2 (buk2)
MBS1451196-06 0.2 mg (Yeast)

Recombinant Thermoanaerobacter tengcongensis Probable butyrate kinase 2 (buk2)

Sign In for Pricing
View Details