Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial lktA protein

This Bacterial lktA protein spans the amino acid sequence from region 1-229aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LktALeukotoxin, Lkt

UniProt

P55118

Expression Region

1-229aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mannheimia haemolytica (Pasteurella haemolytica)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged: N-terminal 10xHis-tagged and C-terminal Myc-tagged32-240AA: 1-229AAExtracellular Domain: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGNKLTNISTNLKSSWLTAKSGLNRTGQSLAKAGQSLKTGAKKIILYIPKDYQYDTEKGNGLQDLVKAAEELGIEVQKEEGNDIAKAQTSLGTIQNVLGLTERGIVLSAPQLDKLLQKTKVGQAIGSAENLTKGFSNAKTVLSGIQSILGSVLAGMDLDEALQKNSNELTLAKAGLELTNSLIENIANSVKTLDAFGDQINQLGSKLQNVKGLSSLGDKLKGLSGFDKT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TFB1M CRISPR Activation Plasmid (h)
sc-406075-ACT 20 µg

TFB1M CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Procalcitonin (PCT) Antibody
abx101025-01 100 µL

Procalcitonin (PCT) Antibody

Sign In for Pricing
View Details
Procalcitonin (PCT) Antibody
abx101025-02 200 µL

Procalcitonin (PCT) Antibody

Sign In for Pricing
View Details
Procalcitonin (PCT) Antibody
abx101025-03 1 mL

Procalcitonin (PCT) Antibody

Sign In for Pricing
View Details
EHF Antibody
A20312-100UL 100 µL

EHF Antibody

Sign In for Pricing
View Details
C1QTNF4 Rabbit pAb
E45R28468N-50 50 µL

C1QTNF4 Rabbit pAb

Sign In for Pricing
View Details