Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CHRNA3 protein

This Human CHRNA3 protein spans the amino acid sequence from region 32-240aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ACHA3_HUMAN, AChR, Cholinergic receptor neuronal nicotinic alpha polypeptide 3, Cholinergic receptor nicotinic alpha 3, Cholinergic receptor nicotinic alpha polypeptide 3, CHRNA 3, CHRNA3, LNCR2, MGC104879, NACHRA 3, NACHRA3, Neuronal acetylcholine receptor protein alpha 3 chain precursor, Neuronal acetylcholine receptor subunit alpha 3, Neuronal acetylcholine receptor subunit alpha-3, Neuronal nicotinic acetylcholine receptor alpha 3 subunit, PAOD2

UniProt

P32297

Expression Region

32-240aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-tagged: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged26-147AA: 32-240AAFull Length: Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TDRD10 Protein Lysate
MBS8428390-01 0.02 mg

Human TDRD10 Protein Lysate

Sign In for Pricing
View Details
Human TDRD10 Protein Lysate
MBS8428390-02 5x 0.02 mg

Human TDRD10 Protein Lysate

Sign In for Pricing
View Details
C7orf41 Protein Vector (Human) (pPM-C-His)
PV066840 500 ng

C7orf41 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Monkey MHC Class II Transactivator (CIITA) ELISA Kit
MBS9901002-01 48 Well

Monkey MHC Class II Transactivator (CIITA) ELISA Kit

Sign In for Pricing
View Details
Monkey MHC Class II Transactivator (CIITA) ELISA Kit
MBS9901002-02 96 Well

Monkey MHC Class II Transactivator (CIITA) ELISA Kit

Sign In for Pricing
View Details
Monkey MHC Class II Transactivator (CIITA) ELISA Kit
MBS9901002-03 5x 96 Well

Monkey MHC Class II Transactivator (CIITA) ELISA Kit

Sign In for Pricing
View Details