Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FGFR3 protein

This Human FGFR3 protein spans the amino acid sequence from region 397-806aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD_antigen, CD333

UniProt

P22607

Expression Region

397-806aa

Tag

N-terminal 6xHis-B2M-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

59.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-B2M-tagged: N-terminal 6xHis-B2M-tagged27-194AA: 397-806AAFull Length: Cytoplasmic Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RLRSPPKKGLGSPTVHKISRFPLKRQVSLESNASMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGEGCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSSSSSGDDSVFAHDLLPPAPPSSGGSRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ncbp1 (NM_001033201) Mouse Tagged ORF Clone
MG225937 10 µg

Ncbp1 (NM_001033201) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Rat Activin A (ACVA) ELISA Kit
EIA05021r 1 Kit

Rat Activin A (ACVA) ELISA Kit

Sign In for Pricing
View Details
CHCHD10 Mouse Monoclonal Antibody [Clone ID: OTI4C12]
TA811789 100 µL

CHCHD10 Mouse Monoclonal Antibody [Clone ID: OTI4C12]

Sign In for Pricing
View Details
GPT/ALT
CHALT 215H 5x 50 mL

GPT/ALT

Sign In for Pricing
View Details
TWF2 Rabbit Polyclonal Antibody
E10G07962 100 µL

TWF2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CXCR7 modulator 1
MBS3843883-01 1 mg

CXCR7 modulator 1

Sign In for Pricing
View Details