Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CT83 protein

This Human CT83 protein spans the amino acid sequence from region 1-113aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cancer/testis antigen 83

UniProt

Q5H943

Expression Region

1-113aa

Tag

N-terminal 6xHis-B2M-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-tagged: N-terminal 6xHis-B2M-tagged1-113AA: 1-113AAFull Length: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DEFB129 Rabbit Polyclonal Antibody (Biotin)
orb449878 100 µL

DEFB129 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
NRIP3 Peptide
AF9135-BP 1 mg

NRIP3 Peptide

Sign In for Pricing
View Details
MGC15478 Recombinant Protein (Human)
RP019321 100 µg

MGC15478 Recombinant Protein (Human)

Sign In for Pricing
View Details
ALOXE3 Protein Vector (Human) (pPB-His-GST)
PV321407 500 ng

ALOXE3 Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
VCAM1 Antibody
MBS9435456-01 0.05 mL

VCAM1 Antibody

Sign In for Pricing
View Details
VCAM1 Antibody
MBS9435456-02 0.1 mL

VCAM1 Antibody

Sign In for Pricing
View Details