Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Klk8 protein

This Mouse Klk8 protein spans the amino acid sequence from region 33-260aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Neuropsin

UniProt

Q61955

Expression Region

33-260aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-tagged: N-terminal 6xHis-tagged122-241AA: 33-260AAFull Length of Mature Protein : Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ILEGRECIPHSQPWQAALFQGERLICGGVLVGDRWVLTAAHCKKQKYSVRLGDHSLQSRDQPEQEIQVAQSIQHPCYNNSNPEDHSHDIMLIRLQNSANLGDKVKPVQLANLCPKVGQKCIISGWGTVTSPQENFPNTLNCAEVKIYSQNKCERAYPGKITEGMVCAGSSNGADTCQGDSGGPLVCDGMLQGITSWGSDPCGKPEKPGVYTKICRYTTWIKKTMDNRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Cytochrome P450 2J2, CYP2J2 ELISA KIT
ELI-09014h 96 Tests

Human Cytochrome P450 2J2, CYP2J2 ELISA KIT

Sign In for Pricing
View Details
Biotin-Linked Anti-Thioredoxin Reductase 1 (TXNRD1)
FY-AB41895-01 1 mL

Biotin-Linked Anti-Thioredoxin Reductase 1 (TXNRD1)

Sign In for Pricing
View Details
Biotin-Linked Anti-Thioredoxin Reductase 1 (TXNRD1)
FY-AB41895-02 100 µL

Biotin-Linked Anti-Thioredoxin Reductase 1 (TXNRD1)

Sign In for Pricing
View Details
Biotin-Linked Anti-Thioredoxin Reductase 1 (TXNRD1)
FY-AB41895-03 200 µL

Biotin-Linked Anti-Thioredoxin Reductase 1 (TXNRD1)

Sign In for Pricing
View Details
ALDH1B1 Antibody
orb652615 100 µL

ALDH1B1 Antibody

Sign In for Pricing
View Details
p40 (RABEPK) (NM_005833) Human Over-expression Lysate
LY417020 100 µg

p40 (RABEPK) (NM_005833) Human Over-expression Lysate

Sign In for Pricing
View Details