Human MAGOH protein
This Human MAGOH protein spans the amino acid sequence from region 1-146aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Mago nashi homolog proliferation associated (Drosophila), Mago nashi protein homolog, magoh, MAGOHA, MGN_HUMAN, Protein mago nashi homolog
UniProt
P61326
Expression Region
1-146aa
Tag
N-terminal GST-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Epigenetics & Chromatin
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
44.2 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
N-terminal GST-tagged: N-terminal GST-tagged1-349AA: 1-146AAFull Length : Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6211147-01 0.1 mL
DIAPH1 (Protein Diaphanous Homolog 1, Diaphanous-related Formin-1, DRF1, DIAP1) (MaxLight 550)
Sign In for Pricing
View Details MBS6211147-02 5x 0.1 mL
DIAPH1 (Protein Diaphanous Homolog 1, Diaphanous-related Formin-1, DRF1, DIAP1) (MaxLight 550)
Sign In for Pricing
View Details 
MBS1097959-01 0.02 mg (E-Coli)
Recombinant Bacteroides vulgatus Altronate oxidoreductase (uxaB)
Sign In for Pricing
View Details MBS1097959-02 0.02 mg (Yeast)
Recombinant Bacteroides vulgatus Altronate oxidoreductase (uxaB)
Sign In for Pricing
View Details MBS1097959-03 0.1 mg (E-Coli)
Recombinant Bacteroides vulgatus Altronate oxidoreductase (uxaB)
Sign In for Pricing
View Details MBS1097959-04 0.1 mg (Yeast)
Recombinant Bacteroides vulgatus Altronate oxidoreductase (uxaB)
Sign In for Pricing
View Details