Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MAGOH protein

This Human MAGOH protein spans the amino acid sequence from region 1-146aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mago nashi homolog proliferation associated (Drosophila), Mago nashi protein homolog, magoh, MAGOHA, MGN_HUMAN, Protein mago nashi homolog

UniProt

P61326

Expression Region

1-146aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-349AA: 1-146AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100A7 Antibody / Psoriasin
F43261-0.4ML 0.4 mL

S100A7 Antibody / Psoriasin

Sign In for Pricing
View Details
Hsa-miR-539-5p antagomir
HY-RI01621A-01 5 nmol

Hsa-miR-539-5p antagomir

Sign In for Pricing
View Details
Hsa-miR-539-5p antagomir
HY-RI01621A-02 20 nmol

Hsa-miR-539-5p antagomir

Sign In for Pricing
View Details
DUSP2 Rabbit Polyclonal Antibody (APC-Cy7)
orb2391865 100 µL

DUSP2 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
Afegostat
BA7759-1 1 mg

Afegostat

Sign In for Pricing
View Details
(3-methyl-4- (isopropyl) phenyl) (8-quinolylsulfonyl) amine
ZQB41133 250 mg

(3-methyl-4- (isopropyl) phenyl) (8-quinolylsulfonyl) amine

Sign In for Pricing
View Details