Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RAB18 protein

This Human RAB18 protein spans the amino acid sequence from region 1-206aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AA959686, RAB18, RAB18 small GTPase, RAB18, member RAS oncogene family, RAB18_HUMAN, RAB18LI1, Ras related protein Rab 18, Ras-asssociated protein RAB18, Ras-related protein Rab-18, RP11-148B2.1, WARBM3

UniProt

Q9NP72

Expression Region

1-206aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-188AA: 1-206AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQGGGACGGYC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IL12B Protein, Fc Tag
E40MOP1792 20 µg

Mouse IL12B Protein, Fc Tag

Sign In for Pricing
View Details
CHRNB1 Antibody
A19371-50UG 50 µg

CHRNB1 Antibody

Sign In for Pricing
View Details
HnRNP E2 (F-3) : m-IgG Fc BP-HRP Bundle
sc-538729 1 Kit

HnRNP E2 (F-3) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
Emi1 Rabbit pAb
APA3032-01 30 µL

Emi1 Rabbit pAb

Sign In for Pricing
View Details
Emi1 Rabbit pAb
APA3032-02 50 μL

Emi1 Rabbit pAb

Sign In for Pricing
View Details
Emi1 Rabbit pAb
APA3032-03 100 µL

Emi1 Rabbit pAb

Sign In for Pricing
View Details