Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RAB18 protein

This Human RAB18 protein spans the amino acid sequence from region 1-206aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AA959686, RAB18, RAB18 small GTPase, RAB18, member RAS oncogene family, RAB18_HUMAN, RAB18LI1, Ras related protein Rab 18, Ras-asssociated protein RAB18, Ras-related protein Rab-18, RP11-148B2.1, WARBM3

UniProt

Q9NP72

Expression Region

1-206aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-188AA: 1-206AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQGGGACGGYC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal AIF Antibody (3C11) [DyLight 350]
NBP2-50606UV 0.1 mL

Mouse Monoclonal AIF Antibody (3C11) [DyLight 350]

Sign In for Pricing
View Details
Human E74 like factor 1 (ELF1) (NM_172373) AAV Particle
RC207140A1V 250 µL

Human E74 like factor 1 (ELF1) (NM_172373) AAV Particle

Sign In for Pricing
View Details
IL-12 p70
MBS692637-01 0.1 mg

IL-12 p70

Sign In for Pricing
View Details
IL-12 p70
MBS692637-02 5x 0.1 mg

IL-12 p70

Sign In for Pricing
View Details
RGD1563216 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6366702 1.0 µg DNA

RGD1563216 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Anti-CACTIN antibody
STJ98657 200 µl

Anti-CACTIN antibody

Sign In for Pricing
View Details