Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MOCS2 protein

This Human MOCS2 protein spans the amino acid sequence from region 1-188aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MOCO1-B Molybdenum cofactor synthesis protein 2 large subunit Molybdenum cofactor synthesis protein 2B

UniProt

O96007

Expression Region

1-188aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-226AA: 1-188AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSSLEISSSCFSLETKLPLSPPLVEDSAFEPSRKDMDEVEEKSKDVINFTAEKLSVDEVSQLVISPLCGAISLFVGTTRNNFEGKKVISLEYEAYLPMAENEVRKICSDIRQKWPVKHIAVFHRLGLVPVSEASIIIAVSSAHRAASLEAVSYAIDTLKAKVPIWKKEIYEESSTWKGNKECFWASNS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cga sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4766203 1.0 µg DNA

Cga sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Rabbit Monoclonal CD2 Antibody (118) [Allophycocyanin]
NBP2-89731APC 0.1 mL

Rabbit Monoclonal CD2 Antibody (118) [Allophycocyanin]

Sign In for Pricing
View Details
West Nile Virus Nonstructural protein 1 IgG Antibody ELISA Kit, Monkey
VACY-1022-CY634 1 Kit

West Nile Virus Nonstructural protein 1 IgG Antibody ELISA Kit, Monkey

Sign In for Pricing
View Details
Soil Test Kit for Secondary Nutrients (Mg, Ca, SO₄ and Cl)
K105-1KT 1 Kit

Soil Test Kit for Secondary Nutrients (Mg, Ca, SO₄ and Cl)

Sign In for Pricing
View Details
Rabbit Polyclonal IA-2/PTPRN Antibody
NBP1-59411 100 µL

Rabbit Polyclonal IA-2/PTPRN Antibody

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Uncharacterized protein DDB_G0280315 (DDB_G0280315)
MBS1286457-01 0.02 mg (E-Coli)

Recombinant Dictyostelium discoideum Uncharacterized protein DDB_G0280315 (DDB_G0280315)

Sign In for Pricing
View Details