Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MOCS2 protein

This Human MOCS2 protein spans the amino acid sequence from region 1-188aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MOCO1-B Molybdenum cofactor synthesis protein 2 large subunit Molybdenum cofactor synthesis protein 2B

UniProt

O96007

Expression Region

1-188aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-226AA: 1-188AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSSLEISSSCFSLETKLPLSPPLVEDSAFEPSRKDMDEVEEKSKDVINFTAEKLSVDEVSQLVISPLCGAISLFVGTTRNNFEGKKVISLEYEAYLPMAENEVRKICSDIRQKWPVKHIAVFHRLGLVPVSEASIIIAVSSAHRAASLEAVSYAIDTLKAKVPIWKKEIYEESSTWKGNKECFWASNS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CD217/IL17RA, N-His
MBS1575134-01 0.1 mg

Recombinant Human CD217/IL17RA, N-His

Sign In for Pricing
View Details
Recombinant Human CD217/IL17RA, N-His
MBS1575134-02 1 mg

Recombinant Human CD217/IL17RA, N-His

Sign In for Pricing
View Details
Recombinant Human CD217/IL17RA, N-His
MBS1575134-03 5x 1 mg

Recombinant Human CD217/IL17RA, N-His

Sign In for Pricing
View Details
Lentiviral human SPATA2L shRNA (UAS) - Lentiviral human SPATA2L shRNA (UAS, iRFP) (25)
GTR15084194 1 Vial

Lentiviral human SPATA2L shRNA (UAS) - Lentiviral human SPATA2L shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Mouse Retnlb (NM_023881) AAV Particle
MR200360A1V 250 µL

Mouse Retnlb (NM_023881) AAV Particle

Sign In for Pricing
View Details
Culture Medium for Human Ovarian Cancer Adenocarcinoma Cells+Luc [OVCAR-8+Luc]
AFG-ELL-3117-01 125 mL

Culture Medium for Human Ovarian Cancer Adenocarcinoma Cells+Luc [OVCAR-8+Luc]

Sign In for Pricing
View Details