Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MOCS2 protein

This Human MOCS2 protein spans the amino acid sequence from region 1-188aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MOCO1-B Molybdenum cofactor synthesis protein 2 large subunit Molybdenum cofactor synthesis protein 2B

UniProt

O96007

Expression Region

1-188aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-226AA: 1-188AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSSLEISSSCFSLETKLPLSPPLVEDSAFEPSRKDMDEVEEKSKDVINFTAEKLSVDEVSQLVISPLCGAISLFVGTTRNNFEGKKVISLEYEAYLPMAENEVRKICSDIRQKWPVKHIAVFHRLGLVPVSEASIIIAVSSAHRAASLEAVSYAIDTLKAKVPIWKKEIYEESSTWKGNKECFWASNS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CGG triplet repeat-binding protein 1 (CGGBP1) Human ELISA Kit
C3139 96 Tests

CGG triplet repeat-binding protein 1 (CGGBP1) Human ELISA Kit

Sign In for Pricing
View Details
Anti-human CD235a GYPA Monoclonal Antibody Biotin Conjugated, Flow Validated
FC02184-Biotin 100 µg

Anti-human CD235a GYPA Monoclonal Antibody Biotin Conjugated, Flow Validated

Sign In for Pricing
View Details
SHP-1 (Phospho-Tyr536) Antibody
ABM0383 100 µL

SHP-1 (Phospho-Tyr536) Antibody

Sign In for Pricing
View Details
AVPR2 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-10014R-BF405 100 µL

AVPR2 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
RCAN1 Antibody
CSB-PA019500GA01HU 100 µL

RCAN1 Antibody

Sign In for Pricing
View Details
Human ADP ribosylation factor binding protein GGA1 (GGA1) ELISA Kit
MBS7217214-01 48 Well

Human ADP ribosylation factor binding protein GGA1 (GGA1) ELISA Kit

Sign In for Pricing
View Details