Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MOCS2 protein

This Human MOCS2 protein spans the amino acid sequence from region 1-188aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MOCO1-B Molybdenum cofactor synthesis protein 2 large subunit Molybdenum cofactor synthesis protein 2B

UniProt

O96007

Expression Region

1-188aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-226AA: 1-188AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSSLEISSSCFSLETKLPLSPPLVEDSAFEPSRKDMDEVEEKSKDVINFTAEKLSVDEVSQLVISPLCGAISLFVGTTRNNFEGKKVISLEYEAYLPMAENEVRKICSDIRQKWPVKHIAVFHRLGLVPVSEASIIIAVSSAHRAASLEAVSYAIDTLKAKVPIWKKEIYEESSTWKGNKECFWASNS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MyD88 Polyclonal Antibody
E-AB-65719-01 60 µL

MyD88 Polyclonal Antibody

Sign In for Pricing
View Details
MyD88 Polyclonal Antibody
E-AB-65719-02 120 µL

MyD88 Polyclonal Antibody

Sign In for Pricing
View Details
MyD88 Polyclonal Antibody
E-AB-65719-03 200 µL

MyD88 Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human ZFPM2 sgRNA gene knockout kit - Lentiviral human ZFPM2 sgRNA gene knockout kit (100)
GTR15395326 1 Vial

Lentiviral human ZFPM2 sgRNA gene knockout kit - Lentiviral human ZFPM2 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
COX2 Recombinant Rabbit mAb
ARM2504-01 30 µL

COX2 Recombinant Rabbit mAb

Sign In for Pricing
View Details
COX2 Recombinant Rabbit mAb
ARM2504-02 50 μL

COX2 Recombinant Rabbit mAb

Sign In for Pricing
View Details