Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GATC protein

This Human GATC protein spans the amino acid sequence from region 1-136aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein 15E1.2

UniProt

O43716

Expression Region

1-136aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-222AA: 1-136AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MWSRLVWLGLRAPLGGRQGFTSKADPQGSGRITAAVIEHLERLALVDFGSREAVARLEKAIAFADRLRAVDTDGVEPMESVLEDRCLYLRSDNVVEGNCADELLQNSHRVVEEYFVAPPGNISLPKLDEQEPFPHS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polr3h ORF Vector (Mouse) (pORF)
ORF054478 1.0 µg DNA

Polr3h ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Lentiviral human SNX30 shRNA (UAS) - Lentiviral human SNX30 shRNA (UAS, iRFP) (25)
GTR15113390 1 Vial

Lentiviral human SNX30 shRNA (UAS) - Lentiviral human SNX30 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Phospho-Hsp90 beta (Ser226) Rabbit Polyclonal Antibody (RBITC)
orb1071644 100 µL

Phospho-Hsp90 beta (Ser226) Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
LRIG1 Rabbit Polyclonal Antibody (BF680)
orb2480265 100 µL

LRIG1 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
Anti-Apolipoprotein E/APOE Antibody Picoband® (APC Conjugate)
PB9327-APC 100 µg/Vial

Anti-Apolipoprotein E/APOE Antibody Picoband® (APC Conjugate)

Sign In for Pricing
View Details
Recombinant Bacillus cereus Uncharacterized N-acetyltransferase BC_3921 (BC_3921)
MBS1433603-01 0.02 mg (E-Coli)

Recombinant Bacillus cereus Uncharacterized N-acetyltransferase BC_3921 (BC_3921)

Sign In for Pricing
View Details