Human RGS10 protein
This Human RGS10 protein spans the amino acid sequence from region 1-181aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Regulator of G protein signaling 10, Regulator of G-protein signaling 10, RGS10, RGS10_HUMAN
UniProt
O43665
Expression Region
1-181aa
Tag
N-terminal GST-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Signal Transduction
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
48.2 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
N-terminal GST-tagged: N-terminal GST-tagged1-154AA: 1-181AAFull Length of Isoform 2 : Full Length of Isoform 3
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MFNRAVSRLSRKRPPSDIHDSDGSSSSSHQSLKSTAKWAASLENLLEDPEGVKRFREFLKKEFSEENVLFWLACEDFKKMQDKTQMQEKAKEIYMTFLSSKASSQVNVEGQSRLNEKILEEPHPLMFQKLQDQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
127308-ML650 100 µL
GIMAP5 (GTPase IMAP Family Member 5, Immunity-associated Nucleotide 4-like 1 Protein, IAN4L1, Immunity-associated Nucleotide 5 Protein, hIAN5, IAN-5, Immunity-associated Protein 3, IMAP3, FLJ11296) (MaxLight 650)
Sign In for Pricing
View Details 
PB9525-carrier-free 100 µg/Vial
Anti-Bcl10 Antibody Picoband® (Carrier-free Conjugate)
Sign In for Pricing
View Details 
MBS6410693-01 0.1 mL
CDC45 (Cell Division Control Protein 45 Homolog, CDC45L, CDC45L2, PORC-PI-1) (HRP)
Sign In for Pricing
View Details MBS6410693-02 5x 0.1 mL
CDC45 (Cell Division Control Protein 45 Homolog, CDC45L, CDC45L2, PORC-PI-1) (HRP)
Sign In for Pricing
View Details