Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RGS10 protein

This Human RGS10 protein spans the amino acid sequence from region 1-181aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Regulator of G protein signaling 10, Regulator of G-protein signaling 10, RGS10, RGS10_HUMAN

UniProt

O43665

Expression Region

1-181aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-154AA: 1-181AAFull Length of Isoform 2 : Full Length of Isoform 3

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MFNRAVSRLSRKRPPSDIHDSDGSSSSSHQSLKSTAKWAASLENLLEDPEGVKRFREFLKKEFSEENVLFWLACEDFKKMQDKTQMQEKAKEIYMTFLSSKASSQVNVEGQSRLNEKILEEPHPLMFQKLQDQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cdca5 3'UTR GFP Stable Cell Line
TU252054 1.0 mL

Cdca5 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Human ADI1 Protein, N-His
ARO-P12108-01 50 µg

Recombinant Human ADI1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human ADI1 Protein, N-His
ARO-P12108-02 100 µg

Recombinant Human ADI1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human ADI1 Protein, N-His
ARO-P12108-03 1 mg

Recombinant Human ADI1 Protein, N-His

Sign In for Pricing
View Details
DPYD Rabbit Polyclonal Antibody (PerCP)
orb2385089 100 µL

DPYD Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
TMPRSS7 Protein Vector (Rat) (pPB-N-His)
PV311971 500 ng

TMPRSS7 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details