Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RGS10 protein

This Human RGS10 protein spans the amino acid sequence from region 1-181aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Regulator of G protein signaling 10, Regulator of G-protein signaling 10, RGS10, RGS10_HUMAN

UniProt

O43665

Expression Region

1-181aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-154AA: 1-181AAFull Length of Isoform 2 : Full Length of Isoform 3

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MFNRAVSRLSRKRPPSDIHDSDGSSSSSHQSLKSTAKWAASLENLLEDPEGVKRFREFLKKEFSEENVLFWLACEDFKKMQDKTQMQEKAKEIYMTFLSSKASSQVNVEGQSRLNEKILEEPHPLMFQKLQDQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-RANK/Tnfrsf11a Picoband® Antibody (Biotine Conjugate)
A01064-3-Biotin 100 µg/Vial

Anti-RANK/Tnfrsf11a Picoband® Antibody (Biotine Conjugate)

Sign In for Pricing
View Details
Slit Homolog 2
549976 200 µL

Slit Homolog 2

Sign In for Pricing
View Details
CYP4B1 Rabbit Polyclonal Antibody (HRP)
orb477954 100 µL

CYP4B1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
FBP1 Polyclonal Antibody
MBS2521020-01 0.02 mL

FBP1 Polyclonal Antibody

Sign In for Pricing
View Details
FBP1 Polyclonal Antibody
MBS2521020-02 0.06 mL

FBP1 Polyclonal Antibody

Sign In for Pricing
View Details
FBP1 Polyclonal Antibody
MBS2521020-03 0.12 mL

FBP1 Polyclonal Antibody

Sign In for Pricing
View Details