Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FGF12 protein

This Human FGF12 protein spans the amino acid sequence from region 1-181aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fibroblast growth factor homologous factor 1

UniProt

P61328

Expression Region

1-181aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-283AA: 1-181AAFull Length of Isoform 6 : Full Length of Isoform 2

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibrinogen antibody (HRP)
60R-1011 0.2 mg

Fibrinogen antibody (HRP)

Sign In for Pricing
View Details
Arsg 3'UTR Luciferase Stable Cell Line
TU102165 1.0 mL

Arsg 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
TMEM42 Rabbit Polyclonal Antibody (FITC)
orb2108856 100 µL

TMEM42 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
DQB1 rabbit pAb
MBS8600694-01 0.1 mL

DQB1 rabbit pAb

Sign In for Pricing
View Details
DQB1 rabbit pAb
MBS8600694-02 0.1 mL (AF405L)

DQB1 rabbit pAb

Sign In for Pricing
View Details
DQB1 rabbit pAb
MBS8600694-03 0.1 mL (AF405S)

DQB1 rabbit pAb

Sign In for Pricing
View Details