Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FGF12 protein

This Human FGF12 protein spans the amino acid sequence from region 1-181aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fibroblast growth factor homologous factor 1

UniProt

P61328

Expression Region

1-181aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-283AA: 1-181AAFull Length of Isoform 6 : Full Length of Isoform 2

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ST3GAL4 Antibody, HRP conjugated
MBS7108216-01 0.05 mg

ST3GAL4 Antibody, HRP conjugated

Sign In for Pricing
View Details
ST3GAL4 Antibody, HRP conjugated
MBS7108216-02 0.1 mg

ST3GAL4 Antibody, HRP conjugated

Sign In for Pricing
View Details
ST3GAL4 Antibody, HRP conjugated
MBS7108216-03 5x 0.1 mg

ST3GAL4 Antibody, HRP conjugated

Sign In for Pricing
View Details
CTP Disodium Salt Dihydrate
CDP001-10 10 g

CTP Disodium Salt Dihydrate

Sign In for Pricing
View Details
PLEKHG5 Protein Vector (Human) (pPM-C-HA)
PV111844 500 ng

PLEKHG5 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Lactobacillus casei Elongation factor Ts (tsf)
MBS1238657-01 0.02 mg (E-Coli)

Recombinant Lactobacillus casei Elongation factor Ts (tsf)

Sign In for Pricing
View Details