Human FGF12 protein
This Human FGF12 protein spans the amino acid sequence from region 1-181aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Fibroblast growth factor homologous factor 1
UniProt
P61328
Expression Region
1-181aa
Tag
N-terminal GST-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Cardiovascular Research
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
47.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
N-terminal GST-tagged: N-terminal GST-tagged1-283AA: 1-181AAFull Length of Isoform 6 : Full Length of Isoform 2
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
P60108 1000 Units/Pack
Cryo Vial, Internal Thread, Star Foot, Silicone Seal, PP, 1.0 mL, Sterile, DNase/RNase free - 1000 un. - ABDOS
Sign In for Pricing
View Details 
EK345111 96 Well
Porcine UBE2A (Ubiquitin Conjugating Enzyme E2A) ValidElisa Kit
Sign In for Pricing
View Details 
D8078 100 mg
Docosahexanoic acid, Methyl Salt (Docosa-4Z, 7Z, 10Z, 13Z, 16Z, 19Z-hezanoic acid)
Sign In for Pricing
View Details