Human CRIP1 protein
This Human CRIP1 protein spans the amino acid sequence from region 2-77aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Cysteine-rich heart protein
UniProt
P50238
Expression Region
2-77aa
Tag
N-terminal GST-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Signal Transduction
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
35.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
N-terminal GST-tagged: N-terminal GST-tagged1-243AA: 1-77AAFull Length : Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
PKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTFK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
247163-Biotin 100 µL
HNF4A (Hepatocyte Nuclear Factor 4, alpha, FLJ39654, HNF4, HNF4a7, HNF4a8, HNF4a9, MODY, MODY1, NR2A1, NR2A21, TCF, TCF14) (Biotin)
Sign In for Pricing
View Details 
GTR15216482 1 Vial
Lentiviral mouse Trpc1 shRNA (UAS) - Lentiviral mouse Trpc1 shRNA (UAS, iRFP) (25)
Sign In for Pricing
View Details 041614 200 µL
SF3B2, ID (SF3B2, SAP145, Splicing factor 3B subunit 2, Pre-mRNA-splicing factor SF3b 145kD subunit, SF3b150, Spliceosome-associated protein 145)
Sign In for Pricing
View Details