Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CRIP1 protein

This Human CRIP1 protein spans the amino acid sequence from region 2-77aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cysteine-rich heart protein

UniProt

P50238

Expression Region

2-77aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-243AA: 1-77AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTFK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KGF/Fgf7 Rabbit Polyclonal Antibody (Cy3)
orb2614855 100 µg

KGF/Fgf7 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Anti-RANBP3 Antibody Picoband®, Carrier-free
A06252-1-carrier-free 100 µg/Vial

Anti-RANBP3 Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
GAK Protein Vector (Rat) (pPM-C-HA)
PV269504 500 ng

GAK Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
ZNF214, NT (ZNF214, BAZ1, Zinc finger protein 214, BWSCR2-associated zinc finger protein 1) (Biotin) discontinued
044154-Biotin 200 µL

ZNF214, NT (ZNF214, BAZ1, Zinc finger protein 214, BWSCR2-associated zinc finger protein 1) (Biotin) discontinued

Sign In for Pricing
View Details
DUX4L18 3'UTR Luciferase Stable Cell Line
TU006429 1.0 mL

DUX4L18 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Rhesus Macaque Interleukin-13
P1326-.01 10 µg

Recombinant Rhesus Macaque Interleukin-13

Sign In for Pricing
View Details