Human ATP6V0D1 protein
This Human ATP6V0D1 protein spans the amino acid sequence from region 1-351aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
32KDA accessory protein V-ATPase 40KDA accessory protein V-ATPase AC39 subunit
UniProt
P61421
Expression Region
1-351aa
Tag
N-terminal GST-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Signal Transduction
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
67.3 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
N-terminal GST-tagged: N-terminal GST-tagged1-149AA: 1-351AAFull Length : Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS629295-01 0.2 mL
AIFM2, ID (AMID, Apoptosis-inducing Factor 2, Apoptosis-inducing Factor Homologous Mitochondrion-associated Inducer Of Death, Apoptosis-inducing Factor-like Mitochondrion-associated Inducer Of Death, FLJ14497, p53-responsive Gene 3 Protein, PRG3, RP11-367
Sign In for Pricing
View Details MBS629295-02 5x 0.2 mL
AIFM2, ID (AMID, Apoptosis-inducing Factor 2, Apoptosis-inducing Factor Homologous Mitochondrion-associated Inducer Of Death, Apoptosis-inducing Factor-like Mitochondrion-associated Inducer Of Death, FLJ14497, p53-responsive Gene 3 Protein, PRG3, RP11-367
Sign In for Pricing
View Details NB600-1273JF585 1 mL
Goat Polyclonal FITC Antibody [Janelia Fluor 585]
Sign In for Pricing
View Details 