Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TPPP protein

This Human TPPP protein spans the amino acid sequence from region 1-219aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

25KDA brain-specific protein TPPP/p25 p24 p25-alpha

UniProt

O94811

Expression Region

1-219aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-248AA: 1-219AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGREMHGKNWSKLCKDCQVIDGRNVTVTDVDIVFSKIKGKSCRTITFEQFQEALEELAKKRFKDKSSEEAVREVHRLIEGKAPIISGVTKAISSPTVSRLTDTTKFTGSHKERFDPSGKGKGKAGRVDLVDESGYVSGYKHAGTYDQKVQGGK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr257 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV634042 1.0 µg DNA

Olr257 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Bcl11a (NM_001159289) Mouse Tagged ORF Clone
MR221883 10 µg

Bcl11a (NM_001159289) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human Follicle Stimulating Hormone Receptor (FSHR) ELISA Kit
DLR-FSHR-Hu-01 48 Tests

Human Follicle Stimulating Hormone Receptor (FSHR) ELISA Kit

Sign In for Pricing
View Details
Human Follicle Stimulating Hormone Receptor (FSHR) ELISA Kit
DLR-FSHR-Hu-02 96 Tests

Human Follicle Stimulating Hormone Receptor (FSHR) ELISA Kit

Sign In for Pricing
View Details
Human TLR7-Strep full length protein-synthetic nanodisc
MBS1883307-01 0.01 mg

Human TLR7-Strep full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Human TLR7-Strep full length protein-synthetic nanodisc
MBS1883307-02 0.05 mg

Human TLR7-Strep full length protein-synthetic nanodisc

Sign In for Pricing
View Details