Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TPPP protein

This Human TPPP protein spans the amino acid sequence from region 1-219aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

25KDA brain-specific protein TPPP/p25 p24 p25-alpha

UniProt

O94811

Expression Region

1-219aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-248AA: 1-219AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGREMHGKNWSKLCKDCQVIDGRNVTVTDVDIVFSKIKGKSCRTITFEQFQEALEELAKKRFKDKSSEEAVREVHRLIEGKAPIISGVTKAISSPTVSRLTDTTKFTGSHKERFDPSGKGKGKAGRVDLVDESGYVSGYKHAGTYDQKVQGGK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lactoferricin B (4-14), bovine TFA
MBS5798947 Inquire

Lactoferricin B (4-14), bovine TFA

Sign In for Pricing
View Details
Inhibin Beta C (INHbC) Antibody (FITC)
abx273802-01 200 µL

Inhibin Beta C (INHbC) Antibody (FITC)

Sign In for Pricing
View Details
Inhibin Beta C (INHbC) Antibody (FITC)
abx273802-02 1 mL

Inhibin Beta C (INHbC) Antibody (FITC)

Sign In for Pricing
View Details
SNF2L Polyclonal Antibody
bs-6015R 100 µL

SNF2L Polyclonal Antibody

Sign In for Pricing
View Details
PSMA7 CRISPR Knock Out 293T Cell Line (Human)
37950141 1x 10^6 Cells / 1.0 mL

PSMA7 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
ZNF319, CT (ZNF319, KIAA1388, Zinc finger protein 319) (Biotin) discontinued
044186-Biotin 200 µL

ZNF319, CT (ZNF319, KIAA1388, Zinc finger protein 319) (Biotin) discontinued

Sign In for Pricing
View Details