Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TPM4 protein

This Human TPM4 protein spans the amino acid sequence from region 1-248aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TM30p1 Tropomyosin-4

UniProt

P67936

Expression Region

1-248aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

55.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-359AA: 1-248AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AGLNSLEAVKRKIQALQQQADEAEDRAQGLQRELDGERERREKAEGDVAALNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTVAKLEKTIDDLEEKLAQAKEENVGLHQTLDQTLNELNCI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chromomycin A3
BIC1009-01 5 mg

Chromomycin A3

Sign In for Pricing
View Details
Chromomycin A3
BIC1009-02 25 mg

Chromomycin A3

Sign In for Pricing
View Details
Chromomycin A3
BIC1009-03 50 mg

Chromomycin A3

Sign In for Pricing
View Details
Chromomycin A3
BIC1009-04 100 mg

Chromomycin A3

Sign In for Pricing
View Details
Chromomycin A3
BIC1009-05 250 mg

Chromomycin A3

Sign In for Pricing
View Details
OXCT2 CRISPRa sgRNA lentivector (set of three targets)(Human)
35841121 3x 1.0µg DNA

OXCT2 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details