Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TPM4 protein

This Human TPM4 protein spans the amino acid sequence from region 1-248aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TM30p1 Tropomyosin-4

UniProt

P67936

Expression Region

1-248aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

55.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-359AA: 1-248AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AGLNSLEAVKRKIQALQQQADEAEDRAQGLQRELDGERERREKAEGDVAALNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTVAKLEKTIDDLEEKLAQAKEENVGLHQTLDQTLNELNCI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MPP2 antibody
70R-13087 100 ul

MPP2 antibody

Sign In for Pricing
View Details
Recombinant Human NPY2R Protein - (Dry Ice)
H00004887-P01-2ug 2 µg

Recombinant Human NPY2R Protein - (Dry Ice)

Sign In for Pricing
View Details
CARD10, ID (CARD10, CARMA3, Caspase recruitment domain-containing protein 10, CARD-containing MAGUK protein 3) (APC)
MBS6280794-01 0.2 mL

CARD10, ID (CARD10, CARMA3, Caspase recruitment domain-containing protein 10, CARD-containing MAGUK protein 3) (APC)

Sign In for Pricing
View Details
CARD10, ID (CARD10, CARMA3, Caspase recruitment domain-containing protein 10, CARD-containing MAGUK protein 3) (APC)
MBS6280794-02 5x 0.2 mL

CARD10, ID (CARD10, CARMA3, Caspase recruitment domain-containing protein 10, CARD-containing MAGUK protein 3) (APC)

Sign In for Pricing
View Details
Recombinant Vibrio Cholerae rplC Protein (aa 1-209) (strain ATCC 39541 / Ogawa 395 / O395)
VAng-Cr3418-50gEcoli 50 µg (E. coli)

Recombinant Vibrio Cholerae rplC Protein (aa 1-209) (strain ATCC 39541 / Ogawa 395 / O395)

Sign In for Pricing
View Details
Dlgap1 AAV siRNA Pooled Vector
18282164 1.0 µg

Dlgap1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details