Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SAE1 protein

This Human SAE1 protein spans the amino acid sequence from region 1-346aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ubiquitin-like 1-activating enzyme E1A

UniProt

Q9UBE0

Expression Region

1-346aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

65.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-261AA: 1-346AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

METTL19 Protein Vector (Rat) (pPB-N-His)
PV281931 500 ng

METTL19 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
CAV3 siRNA (Rat)
orb1832933-01 15 nmol

CAV3 siRNA (Rat)

Sign In for Pricing
View Details
CAV3 siRNA (Rat)
orb1832933-02 30 nmol

CAV3 siRNA (Rat)

Sign In for Pricing
View Details
Desmin Antibody
MBS856252-01 0.1 mg

Desmin Antibody

Sign In for Pricing
View Details
Desmin Antibody
MBS856252-02 0.1 mL (AF635)

Desmin Antibody

Sign In for Pricing
View Details
Desmin Antibody
MBS856252-03 0.1 mL (AF610)

Desmin Antibody

Sign In for Pricing
View Details