Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PMM2 protein

This Human PMM2 protein spans the amino acid sequence from region 1-246aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AI585868, BOS_22465, C86848, CDG 1, CDG1, CDG1a, CDGS, MGC127449, Phosphomannomutase 2, PMM 2, Pmm2, PMM2_HUMAN

UniProt

O15305

Expression Region

1-246aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

55 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-63AA: 1-246AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAAPGPALCLFDVDGTLTAPRQKITKEMDDFLQKLRQKIKIGVVGGSDFEKVQEQLGNDVVEKYDYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIKLPKKRGTFIEFRNGMLNVSPIGRSCSQEERIEFYELDKKENIRQKFVADLRKEFAGKGLTFSIGGQISFDVFPDGWDKRYCLRHVENDGYKTIYFFGDKTMPGGNDHEIFTDPRTMGYSVTAPEDTRRICELLFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mrpl24 Antibody - C-terminal region : Biotin (ARP41011_P050-Biotin)
ARP41011_P050-Biotin 100 µL

Mrpl24 Antibody - C-terminal region : Biotin (ARP41011_P050-Biotin)

Sign In for Pricing
View Details
Ornidazole Impurity 58
RG-A262453-01 10 mg

Ornidazole Impurity 58

Sign In for Pricing
View Details
Ornidazole Impurity 58
RG-A262453-02 25 mg

Ornidazole Impurity 58

Sign In for Pricing
View Details
Ornidazole Impurity 58
RG-A262453-03 50 mg

Ornidazole Impurity 58

Sign In for Pricing
View Details
Ornidazole Impurity 58
RG-A262453-04 100 mg

Ornidazole Impurity 58

Sign In for Pricing
View Details
Human Protein kinase C gamma type, PRKCG ELISA KIT
ELI-12480h 96 Tests

Human Protein kinase C gamma type, PRKCG ELISA KIT

Sign In for Pricing
View Details