Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NDUFB10 protein

This Human NDUFB10 protein spans the amino acid sequence from region 1-172aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Complex I-PDSW

UniProt

O96000

Expression Region

1-172aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-145AA: 1-172AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPDSWDKDVYPEPPRRTPVQPNPIVYMMKAFDLIVDRPVTLVREFIERQHAKNRYYYYHRQYRRVPDITECKEEDIMCMYEAEMQWKRDYKVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQDLGAYSSARKCLAKQRQRMLQERKAAKEAAAATS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADK discontinued
532809-01 30ul

ADK discontinued

Sign In for Pricing
View Details
ADK discontinued
532809-02 100 µL

ADK discontinued

Sign In for Pricing
View Details
LDLRAP1 siRNA (Human)
orb1859541-01 15 nmol

LDLRAP1 siRNA (Human)

Sign In for Pricing
View Details
LDLRAP1 siRNA (Human)
orb1859541-02 30 nmol

LDLRAP1 siRNA (Human)

Sign In for Pricing
View Details
MGC21881 Protein Vector (Human) (pPM-C-His)
PV055104 500 ng

MGC21881 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Iso-Propyl Alcohol 99% For Synthesis
220102500 2.5 L

Iso-Propyl Alcohol 99% For Synthesis

Sign In for Pricing
View Details