Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NDUFB10 protein

This Human NDUFB10 protein spans the amino acid sequence from region 1-172aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Complex I-PDSW

UniProt

O96000

Expression Region

1-172aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-145AA: 1-172AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPDSWDKDVYPEPPRRTPVQPNPIVYMMKAFDLIVDRPVTLVREFIERQHAKNRYYYYHRQYRRVPDITECKEEDIMCMYEAEMQWKRDYKVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQDLGAYSSARKCLAKQRQRMLQERKAAKEAAAATS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EMD Knockout A549 Polyclonal Cells
ARG10933 1 Million

EMD Knockout A549 Polyclonal Cells

Sign In for Pricing
View Details
OR4A9P ORF Vector (Human) (pORF)
ORF026734 1.0 µg DNA

OR4A9P ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Phospho-CTBP1 (S422) Antibody
MBS7118043-01 0.05 mg

Phospho-CTBP1 (S422) Antibody

Sign In for Pricing
View Details
Phospho-CTBP1 (S422) Antibody
MBS7118043-02 0.1 mg

Phospho-CTBP1 (S422) Antibody

Sign In for Pricing
View Details
Phospho-CTBP1 (S422) Antibody
MBS7118043-03 5x 0.1 mg

Phospho-CTBP1 (S422) Antibody

Sign In for Pricing
View Details
FN1 Antibody
orb1252763 100 µg

FN1 Antibody

Sign In for Pricing
View Details