Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NDUFB10 protein

This Human NDUFB10 protein spans the amino acid sequence from region 1-172aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Complex I-PDSW

UniProt

O96000

Expression Region

1-172aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-145AA: 1-172AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPDSWDKDVYPEPPRRTPVQPNPIVYMMKAFDLIVDRPVTLVREFIERQHAKNRYYYYHRQYRRVPDITECKEEDIMCMYEAEMQWKRDYKVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQDLGAYSSARKCLAKQRQRMLQERKAAKEAAAATS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human ROR1 Antibody (P3A1), PE
MBS1584478-01 50 Tests

Anti-Human ROR1 Antibody (P3A1), PE

Sign In for Pricing
View Details
Anti-Human ROR1 Antibody (P3A1), PE
MBS1584478-02 100 Tests

Anti-Human ROR1 Antibody (P3A1), PE

Sign In for Pricing
View Details
Anti-Human ROR1 Antibody (P3A1), PE
MBS1584478-03 5x 100 Tests

Anti-Human ROR1 Antibody (P3A1), PE

Sign In for Pricing
View Details
Mouse F (ab') 2 IgG1-APC
0115-11 100 Tests

Mouse F (ab') 2 IgG1-APC

Sign In for Pricing
View Details
JAKMIP1 (Janus Kinase and Microtubule Interacting Protein 1, JAMIP1, FLJ31564, GABA-B Receptor-binding Protein, GABABRBP, Multiple alpha-helices and RNA-linker Protein 1, MARLIN1, Marlin-1) (Azide free) (HRP)
MBS6483726-01 0.2 mL

JAKMIP1 (Janus Kinase and Microtubule Interacting Protein 1, JAMIP1, FLJ31564, GABA-B Receptor-binding Protein, GABABRBP, Multiple alpha-helices and RNA-linker Protein 1, MARLIN1, Marlin-1) (Azide free) (HRP)

Sign In for Pricing
View Details
JAKMIP1 (Janus Kinase and Microtubule Interacting Protein 1, JAMIP1, FLJ31564, GABA-B Receptor-binding Protein, GABABRBP, Multiple alpha-helices and RNA-linker Protein 1, MARLIN1, Marlin-1) (Azide free) (HRP)
MBS6483726-02 5x 0.2 mL

JAKMIP1 (Janus Kinase and Microtubule Interacting Protein 1, JAMIP1, FLJ31564, GABA-B Receptor-binding Protein, GABABRBP, Multiple alpha-helices and RNA-linker Protein 1, MARLIN1, Marlin-1) (Azide free) (HRP)

Sign In for Pricing
View Details