Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NDUFA12 protein

This Human NDUFA12 protein spans the amino acid sequence from region 1-145aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

13KDA differentiation-associated protein Complex I-B17.2

UniProt

Q9UI09

Expression Region

1-145aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-114AA: 1-145AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMNGKNTFWDVDGSMVPPEWHRWLHSMTDDPPTTKPLTARKFIWTNHKFNVTGTPEQYVPYSTTRKKIQEWIPPSTPYK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPS35 Antibody
A14686-100UG 100 µg

MRPS35 Antibody

Sign In for Pricing
View Details
Cavy Calpain 2, Large Subunit ELISA Kit
MBS091135 Inquire

Cavy Calpain 2, Large Subunit ELISA Kit

Sign In for Pricing
View Details
3-Piperidin-1-ylbenzonitrile
OR4433 1 Each

3-Piperidin-1-ylbenzonitrile

Sign In for Pricing
View Details
SLC25A44 Antibody - middle region : FITC (ARP43955_P050-FITC)
ARP43955_P050-FITC 100 µL

SLC25A44 Antibody - middle region : FITC (ARP43955_P050-FITC)

Sign In for Pricing
View Details
PTGER4 (Prostaglandin E2 Receptor EP4 Subtype, PGE2 Receptor EP4 Subtype, PGE Receptor EP4 Subtype, Prostaglandin E Receptor 4, Subtype EP4, EP4, EP4R, MGC126583, Prostanoid EP4 Receptor) (HRP)
132020-HRP 100 µL

PTGER4 (Prostaglandin E2 Receptor EP4 Subtype, PGE2 Receptor EP4 Subtype, PGE Receptor EP4 Subtype, Prostaglandin E Receptor 4, Subtype EP4, EP4, EP4R, MGC126583, Prostanoid EP4 Receptor) (HRP)

Sign In for Pricing
View Details
RT1-T24-4 3'UTR Lenti-reporter-Luc Vector
42855086 1.0 µg

RT1-T24-4 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details