Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NDUFA12 protein

This Human NDUFA12 protein spans the amino acid sequence from region 1-145aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

13KDA differentiation-associated protein Complex I-B17.2

UniProt

Q9UI09

Expression Region

1-145aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-114AA: 1-145AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMNGKNTFWDVDGSMVPPEWHRWLHSMTDDPPTTKPLTARKFIWTNHKFNVTGTPEQYVPYSTTRKKIQEWIPPSTPYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-PKA C alpha/beta/gamma (T197) Recombinant Antibody, PE-Cy7 Conjugated
bsm-62860R-PE-Cy7 100 µL

Phospho-PKA C alpha/beta/gamma (T197) Recombinant Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Anti-Rabies Virus antiserum (hyper immune sera)
RBV12-S 100 µL

Anti-Rabies Virus antiserum (hyper immune sera)

Sign In for Pricing
View Details
Olr416 (NM_001000387) Rat Tagged ORF Clone Lentiviral Particle
RR208671L3V 200 µL

Olr416 (NM_001000387) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SCF (KITLG) (NM_000899) Human Tagged Lenti ORF Clone
RC216131L3 10 µg

SCF (KITLG) (NM_000899) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CT47A12 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV721880 1.0 µg DNA

CT47A12 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Uncoupling Protein 3 (UCP3, SLC25A9) (MaxLight 550)
MBS6442585-01 0.1 mL

Uncoupling Protein 3 (UCP3, SLC25A9) (MaxLight 550)

Sign In for Pricing
View Details