Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human COX7A2L protein

This Human COX7A2L protein spans the amino acid sequence from region 1-114aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

COX7a-related protein Cytochrome c oxidase subunit VIIa-related protein EB1

UniProt

O14548

Expression Region

1-114aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-161AA: 1-114AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Rnf149 shRNA (UAS) - Lentiviral mouse Rnf149 shRNA (UAS, RFP) plasmid
GTR15156481 1 Vial

Lentiviral mouse Rnf149 shRNA (UAS) - Lentiviral mouse Rnf149 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
7-[ (1R,2R,3R) -3-Hydroxy-2-[ (3S) -3-hydroxyoctyl]-5-oxocyclopentyl]heptanoyl-CoA
HY-CE01344 1 Each

7-[ (1R,2R,3R) -3-Hydroxy-2-[ (3S) -3-hydroxyoctyl]-5-oxocyclopentyl]heptanoyl-CoA

Sign In for Pricing
View Details
Hsa-miR-4715-5p miRNA Agomir
orb1920000-01 5 nmol

Hsa-miR-4715-5p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-4715-5p miRNA Agomir
orb1920000-02 10 nmol

Hsa-miR-4715-5p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-4715-5p miRNA Agomir
orb1920000-03 20 nmol

Hsa-miR-4715-5p miRNA Agomir

Sign In for Pricing
View Details
Human AIM2 (NM_004833) AAV Particle
RC203120A1V 250 µL

Human AIM2 (NM_004833) AAV Particle

Sign In for Pricing
View Details