Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human COX7A2L protein

This Human COX7A2L protein spans the amino acid sequence from region 1-114aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

COX7a-related protein Cytochrome c oxidase subunit VIIa-related protein EB1

UniProt

O14548

Expression Region

1-114aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-161AA: 1-114AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDIP Peptide
MBS152041-01 0.05 mg

CDIP Peptide

Sign In for Pricing
View Details
CDIP Peptide
MBS152041-02 5x 0.05 mg

CDIP Peptide

Sign In for Pricing
View Details
Porcine Inhibin A (INHA) ELISA Kit
RD-INHA-p-96Tests 96 Tests

Porcine Inhibin A (INHA) ELISA Kit

Sign In for Pricing
View Details
Anti- Bombesin receptor subtype-3 Antibody
GWB-7A5580 0.05 mL

Anti- Bombesin receptor subtype-3 Antibody

Sign In for Pricing
View Details
Bsn sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3829506 1.0 µg DNA

Bsn sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Lentiviral mouse Intu shRNA (UAS) - Lentiviral mouse Intu shRNA (UAS, GFP) plasmid
GTR15249394 1 Vial

Lentiviral mouse Intu shRNA (UAS) - Lentiviral mouse Intu shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details