Human MRPS6 protein
This Human MRPS6 protein spans the amino acid sequence from region 1-125aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
MRPS6, C21orf101, RPMS628S ribosomal protein S6, mitochondrial, MRP-S6, S6mt, Mitochondrial small ribosomal subunit protein bS6m
UniProt
P82932
Expression Region
1-125aa
Tag
N-terminal GST-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
41.1 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
N-terminal GST-tagged: N-terminal GST-tagged1-137AA: 1-125AAFull Length : Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
PRYELALILKAMQRPETAATLKRTIEALMDRGAIVRDLENLGERALPYRISAHSQQHNRGGYFLVDFYAPTAAVESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRKK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2506745 100 µL
GPCR TGR7 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
Sign In for Pricing
View Details 
MBS6352026-01 0.2 mL
Stk24, ID (Stk24, Mst3, Stk3, Serine/threonine-protein kinase 24, Mammalian STE20-like protein kinase 3, STE20-like kinase MST3, Serine/threonine-protein kinase 24 35kD subunit, Mammalian STE20-like protein kinase 3 N-terminal, Serine/threonine-protein ki
Sign In for Pricing
View Details MBS6352026-02 5x 0.2 mL
Stk24, ID (Stk24, Mst3, Stk3, Serine/threonine-protein kinase 24, Mammalian STE20-like protein kinase 3, STE20-like kinase MST3, Serine/threonine-protein kinase 24 35kD subunit, Mammalian STE20-like protein kinase 3 N-terminal, Serine/threonine-protein ki
Sign In for Pricing
View Details