Human MRPS16 protein
This Human MRPS16 protein spans the amino acid sequence from region 1-137aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
28S ribosomal protein S16, 28S ribosomal protein S16 mitochondrial, CGI-132, COXPD2, mitochondrial, Mitochondrial ribosomal protein S16, MRP-S16, mrps16, RPMS16, RT16_HUMAN, S16mt
UniProt
Q9Y3D3
Expression Region
1-137aa
Tag
N-terminal GST-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Epigenetics & Chromatin
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
38.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
N-terminal GST-tagged: N-terminal GST-tagged1-217AA: 1-137AAFull Length : Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
VAAHNKCPRDGRFVEQLGSYDPLPNSHGEKLVALNLDRIRHWIGCGAHLSKPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDTEATET
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2036242-01 1 mL
APC/CY7-Linked Polyclonal Antibody to Interleukin 10 (IL10)
Sign In for Pricing
View Details MBS2036242-02 5 mL
APC/CY7-Linked Polyclonal Antibody to Interleukin 10 (IL10)
Sign In for Pricing
View Details MBS2036242-03 5x 5 mL
APC/CY7-Linked Polyclonal Antibody to Interleukin 10 (IL10)
Sign In for Pricing
View Details 
141436 200 µL
Metastasis Associated In Colon Cancer 1 (MACC1, 7A5, SH3BP4L)
Sign In for Pricing
View Details