Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MRPS16 protein

This Human MRPS16 protein spans the amino acid sequence from region 1-137aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

28S ribosomal protein S16, 28S ribosomal protein S16 mitochondrial, CGI-132, COXPD2, mitochondrial, Mitochondrial ribosomal protein S16, MRP-S16, mrps16, RPMS16, RT16_HUMAN, S16mt

UniProt

Q9Y3D3

Expression Region

1-137aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-217AA: 1-137AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VAAHNKCPRDGRFVEQLGSYDPLPNSHGEKLVALNLDRIRHWIGCGAHLSKPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDTEATET

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human Na+/K+-ATPase α2 Polyclonal Antibody
PA89812HU-01 50 µg

Rabbit Anti-Human Na+/K+-ATPase α2 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Na+/K+-ATPase α2 Polyclonal Antibody
PA89812HU-02 100 µg

Rabbit Anti-Human Na+/K+-ATPase α2 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Na+/K+-ATPase α2 Polyclonal Antibody
PA89812HU-03 500 µg

Rabbit Anti-Human Na+/K+-ATPase α2 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Na+/K+-ATPase α2 Polyclonal Antibody
PA89812HU-04 1 mg

Rabbit Anti-Human Na+/K+-ATPase α2 Polyclonal Antibody

Sign In for Pricing
View Details
SUMO-1 Antibody
orb2639315 7 mL

SUMO-1 Antibody

Sign In for Pricing
View Details
TAZ Antibody
CSB-PA050215-01 50 µg

TAZ Antibody

Sign In for Pricing
View Details