What is the catalog number for Human GRPEL1 protein?

The catalog number for Human GRPEL1 protein is orb54529.

What sizes are available for Human GRPEL1 protein?

Human GRPEL1 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Human GRPEL1 protein come in?

Human GRPEL1 protein is available in 3 different pack sizes.

Is Human GRPEL1 protein in stock?

Human GRPEL1 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human GRPEL1 protein

This Human GRPEL1 protein spans the amino acid sequence from region 1-217aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HMGE Mt-GrpE#1

UniProt

Q9HAV7

Expression Region

1-217aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-116AA: 1-217AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAAQCVRLARRSLPALALSLRPSPRLLCTATKQKNSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALADTENLRQRSQKLVEEAKLYGIQAFCKDLLEVADVLEKATQCVPKEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVKEA