Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GRPEL1 protein

This Human GRPEL1 protein spans the amino acid sequence from region 1-217aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HMGE Mt-GrpE#1

UniProt

Q9HAV7

Expression Region

1-217aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-116AA: 1-217AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAAQCVRLARRSLPALALSLRPSPRLLCTATKQKNSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALADTENLRQRSQKLVEEAKLYGIQAFCKDLLEVADVLEKATQCVPKEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVKEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Sstr1 (NM_009216) AAV Particle
MR224947A1V 250 µL

Mouse Sstr1 (NM_009216) AAV Particle

Sign In for Pricing
View Details
Recombinant Pasteurella Multocida rbsD Protein (aa 1-139)
VAng-Cr7249-1mgEcoli 1 mg (E. coli)

Recombinant Pasteurella Multocida rbsD Protein (aa 1-139)

Sign In for Pricing
View Details
Phospho-HDAC5 (Ser498) Rabbit Polyclonal Antibody (Cy7)
orb1060995 100 µL

Phospho-HDAC5 (Ser498) Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
ADCK4 antibody
OAGA00914-100UL 100 µL

ADCK4 antibody

Sign In for Pricing
View Details
MBOAT4 siRNA (Human)
CRJ8420-01 15 nmol

MBOAT4 siRNA (Human)

Sign In for Pricing
View Details
MBOAT4 siRNA (Human)
CRJ8420-02 30 nmol

MBOAT4 siRNA (Human)

Sign In for Pricing
View Details