Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL36G protein

This Human IL36G protein spans the amino acid sequence from region 1-169aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-1-related protein 2

UniProt

Q9NZH8

Expression Region

1-169aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-158AA: 1-169AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LILRA5 protein, Human, Recombinant (His)
E51P90936 20 µg

LILRA5 protein, Human, Recombinant (His)

Sign In for Pricing
View Details
28S ribosomal protein S18b mitochondrial (MRPS18B) Bovine ELISA Kit
B0457 96 Tests

28S ribosomal protein S18b mitochondrial (MRPS18B) Bovine ELISA Kit

Sign In for Pricing
View Details
HIV-1 p24, Capsid Protein (Human Immunodeficiency Virus-1) (MaxLight 550) discontinued
H6009-60-ML550 100 µL

HIV-1 p24, Capsid Protein (Human Immunodeficiency Virus-1) (MaxLight 550) discontinued

Sign In for Pricing
View Details
AdmiRa-Off-hsa-miR-4787-3p Virus
mh6797 1.0 mL

AdmiRa-Off-hsa-miR-4787-3p Virus

Sign In for Pricing
View Details
Inhibitor hsa-miR-548q AAV miRNA Vector
Amh3099600 500 ng

Inhibitor hsa-miR-548q AAV miRNA Vector

Sign In for Pricing
View Details
Mouse Monoclonal Cystatin SN Antibody (MM0234-5N51) [DyLight 405]
NBP2-12255V 0.1 mL

Mouse Monoclonal Cystatin SN Antibody (MM0234-5N51) [DyLight 405]

Sign In for Pricing
View Details