What is the catalog number for Human CETN3 protein?

The catalog number for Human CETN3 protein is orb54517.

What sizes are available for Human CETN3 protein?

Human CETN3 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Human CETN3 protein come in?

Human CETN3 protein is available in 3 different pack sizes.

Is Human CETN3 protein in stock?

Human CETN3 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human CETN3 protein

This Human CETN3 protein spans the amino acid sequence from region 1-167aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CDC31 homolog, CEN 3, CEN3, Centrin EF hand protein 3, Centrin-3, Centrin3, CETN 3, Cetn3, CETN3_HUMAN, EF hand superfamily member, MGC12502, MGC138245

UniProt

O15182

Expression Region

1-167aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Disease Biomarkers

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-172AA: 1-167AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDEELRAMIEEFDKDGDGEINQEEFIAIMTGDI