Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CETN1 protein

This Human CETN1 protein spans the amino acid sequence from region 1-172aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Caltractin isoform 2

UniProt

Q12798

Expression Region

1-172aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-269AA: 1-172AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGKISFKNLKRVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMP2KL sgRNA CRISPR Lentivector (Human) (Target 1)
K0187402 1.0 µg DNA

BMP2KL sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Ppif (NM_172243) Rat Tagged ORF Clone
RR201181 10 µg

Ppif (NM_172243) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Thalidomide-C-amide-C5-amine
HY-176336 1 Each

Thalidomide-C-amide-C5-amine

Sign In for Pricing
View Details
Lentiviral human EPHB1 shRNA (UAS) - Lentiviral human EPHB1 shRNA (UAS, GFP) (25)
GTR15090320 1 Vial

Lentiviral human EPHB1 shRNA (UAS) - Lentiviral human EPHB1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
AIM2 AAV Vector (Human) (CMV)
11605101 1 µg

AIM2 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Mouse Monoclonal Rac1 Antibody (CPTC-RAC1-1) [HRP]
NBP3-08939H 100 µL

Mouse Monoclonal Rac1 Antibody (CPTC-RAC1-1) [HRP]

Sign In for Pricing
View Details