What is the catalog number for Human MSRB3 protein?

The catalog number for Human MSRB3 protein is orb54511.

What sizes are available for Human MSRB3 protein?

Human MSRB3 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Human MSRB3 protein come in?

Human MSRB3 protein is available in 3 different pack sizes.

Is Human MSRB3 protein in stock?

Human MSRB3 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human MSRB3 protein

This Human MSRB3 protein spans the amino acid sequence from region 1-185aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Deafness, Autosomal Recessive 74, DFNB74, FLJ36866, Methionine R sulfoxide reductase B mitochondrial, Methionine sulfoxide reductase B3, Methionine-R-sulfoxide reductase B3, MsrB3, MSRB3_HUMAN

UniProt

Q8IXL7

Expression Region

1-185aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-327AA: 1-185AAFull Length : Full Length of Isoform 2

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSAFNLLHLVTKSQPVALRACGLPSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVASPAQADKAEL