Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MSRB3 protein

This Human MSRB3 protein spans the amino acid sequence from region 1-185aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Deafness, Autosomal Recessive 74, DFNB74, FLJ36866, Methionine R sulfoxide reductase B mitochondrial, Methionine sulfoxide reductase B3, Methionine-R-sulfoxide reductase B3, MsrB3, MSRB3_HUMAN

UniProt

Q8IXL7

Expression Region

1-185aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-327AA: 1-185AAFull Length : Full Length of Isoform 2

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSAFNLLHLVTKSQPVALRACGLPSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVASPAQADKAEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hamster Anti-Mouse CD3e-PE
MBS673140-01 0.1 mg

Hamster Anti-Mouse CD3e-PE

Sign In for Pricing
View Details
Hamster Anti-Mouse CD3e-PE
MBS673140-02 5x 0.1 mg

Hamster Anti-Mouse CD3e-PE

Sign In for Pricing
View Details
Anti-Glyoxalase II/HAGH Antibody (1H602)
TMAY-02255 100 µL

Anti-Glyoxalase II/HAGH Antibody (1H602)

Sign In for Pricing
View Details
CLD20 Polyclonal Antibody
E44H08209 100 µL

CLD20 Polyclonal Antibody

Sign In for Pricing
View Details
Kank2 Polyclonal Antibody
CAC11595-01 50 µg

Kank2 Polyclonal Antibody

Sign In for Pricing
View Details
Kank2 Polyclonal Antibody
CAC11595-02 100 µg

Kank2 Polyclonal Antibody

Sign In for Pricing
View Details